Sermorelin (GRF 1-29 ) 2mg
Sermorelin (GRF 1-29 ) 2mg Research Handling Note: For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Re
Sermorelin (GRF 1-29 ) 2mg
Research Handling Note:
For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.
Stock: 1627
Model: Sermorelin 2mg
Molecular Formula: C149H246N44O42S
SKU: SER-022
Research Only: Yes
Certificate of analysis
Description
Technical Data
Sermorelin Acetate 2mg - High-Quality Research Peptide
Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.
Product Name: Sermorelin Acetate 2mg
Catalogue Number: UKSERM2
Molecular Weight: 3358.9 g/mol
Purity: ≥98%
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)
Form: Lyophilised Solid
Usage and Storage:
Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Synthesis and Quality Assurance:
Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Legal and Safety Information:
UK-Peptides proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.
If you require high-quality Sermorelin Acetate for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.
Identification
Molecular Weight (g/mol)
3417.985 g/mol
Physical and Chemical Properties
Molecular Formula
C151H250N44O44S
Physical Appearance
White lyophilised solid
Appearance
White to off-white lyophilised powder
Melting Point
Not applicable (decomposes before melting)
Research Use and Safety
Caution
Research use only / Not for human or veterinary use
Intended Use
For laboratory research use only. Not for human or veterinary use.
Hazard Classification
Not classified as hazardous under GHS for research quantities
Storage, Handling and Stability
Storage Temperature, Opened
Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide, it should be stored at 4°C between 2-21 days and for future use below -18°C.
Storage Temperature, Unopened
-20 °C recommended for long-term storage
Shelf Life
2 years unopened under recommended conditions
Reconstitution Stability
Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions