Skip to content
Recovery & Performance PeptidesRecovery research and practical context
Recovery article

Sermorelin (GRF 1-29 ) 2mg

Sermorelin (GRF 1-29 ) 2mg Research Handling Note: For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Re

Sermorelin (GRF 1-29 ) 2mg

Research Handling Note:

For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Stock: 1627

Model: Sermorelin 2mg

Molecular Formula: C149H246N44O42S

SKU: SER-022

Research Only: Yes

Certificate of analysis

Description

Technical Data

Sermorelin Acetate 2mg - High-Quality Research Peptide

Sermorelin Acetate, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology and related fields. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: Sermorelin Acetate 2mg

Catalogue Number: UKSERM2

Molecular Weight: 3358.9 g/mol

Purity: ≥98%

Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)

Form: Lyophilised Solid

Usage and Storage:

Sermorelin Acetate is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

Sermorelin Acetate is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides Sermorelin Acetate strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including Sermorelin Acetate, are not designed for human consumption or clinical application.

If you require high-quality Sermorelin Acetate for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification

Molecular Weight (g/mol)

3417.985 g/mol

Physical and Chemical Properties

Molecular Formula

C151H250N44O44S

Physical Appearance

White lyophilised solid

Appearance

White to off-white lyophilised powder

Melting Point

Not applicable (decomposes before melting)

Research Use and Safety

Caution

Research use only / Not for human or veterinary use

Intended Use

For laboratory research use only. Not for human or veterinary use.

Hazard Classification

Not classified as hazardous under GHS for research quantities

Storage, Handling and Stability

Storage Temperature, Opened

Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide, it should be stored at 4°C between 2-21 days and for future use below -18°C.

Storage Temperature, Unopened

-20 °C recommended for long-term storage

Shelf Life

2 years unopened under recommended conditions

Reconstitution Stability

Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions