Skip to content
Recovery & Performance PeptidesRecovery research and practical context
Recovery article

Thymosin Beta 4 2mg (TB500)

Thymosin Beta 4 2mg (TB500) Research Handling Note: For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *R

Thymosin Beta 4 2mg (TB500)

Research Handling Note:

For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Stock: 2591

Model: Thymosin Beta 4 2mg (TB500)

Molecular Formula: C212H350N56O78S

SKU: TB2-022

Research Only: Yes

Certificate of analysis

Description

Technical Data

TB-500 2mg - High-Quality Research Peptide

TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: TB-500 2mg

Catalogue Number: TB500-2mg

Molecular Weight: 4963.4 g/mol

Purity: ≥98%

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification

Molecular Weight (g/mol)

4963.44 g/mol

Peptide Sequence

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

Physical and Chemical Properties

Molecular Formula

C212H350N56O78S

Physical Appearance

White lyophilised solid

Form

Sterile filtered white lyophilized (freeze-dried)

Solubility

Aqueous soluble

Appearance

White to off-white lyophilised powder

Melting Point

Not applicable (decomposes before melting)

Analytical and Quality Control

HPLC Result

Shows min 98% purity

Mass Spectrum

Consistent with structure

Purity %

>98%

Research Use and Safety

Caution

Research use only / Not for human or veterinary use

Intended Use

For laboratory research use only. Not for human or veterinary use.

Hazard Classification

Not classified as hazardous under GHS for research quantities

Storage, Handling and Stability

Storage Temperature, Opened

Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.

Storage Temperature, Unopened

-20 °C recommended for long-term storage

Shelf Life

2 years unopened under recommended conditions

Reconstitution Stability

Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions

CONNECTED / MODULES

Post-session references

Selected from shared article topics. Source links are retained where available.

01

Handling & safety lane

Source-derived education, not individual medical guidance or an instruction to dose.

DOSAGE SOURCE

Quick Dosing Reference · research convention, not a validated dose

4 100 0.1mg 10 250 0.25mg 20 500 0.5mg 750 0.75mg 40 1000 1mg
03

Evidence cooldown

Research context and source excerpts for a slower second read.

RESEARCH

Published Studies

Thymosin Beta-4 Ophthalmic Solution for Dry Eye: A Randomized, Double-Masked, Placebo-Controlled Clinical Trialhttps://pmc.ncbi.nlm.nih.gov/articles/PMC4445951/ Thymosin β4 Significantly Improves Signs and Symptoms of Severe Dry Eye Diseasehttps://pubmed.ncbi.nlm.nih.gov/25826322/ RGN-259 Thymosin β4 Improves Clinically Important Dry Eye Efficacy Measures in Comparison With Vehicle in a Phase 2 Clinical Trialhttps://www.nature.com/articles/s41598-018-28861-5 Comparative Study of Thymosin Beta-4 Eye Drops vs. Vehicle for Dry Eyehttps://clinicaltrials.gov/study/NCT01393132 Thymosin Beta-4 Accelerates Wound Healinghttps://pubmed.ncbi.nlm.nih.gov/10469335/ Thymosin Beta-4 Promotes Corneal Wound Healing and Decreases Inflammation In Vivo Following Alkali Injuryhttps://pubmed.ncbi.nlm.nih.gov/11950239/ Thymosin Beta-4 and a Synthetic Peptide Containing Its Actin-Binding Domain Promote Dermal Wound Repairhttps://pubmed.ncbi.nlm.nih.gov/12581423/ Recombinant Thymosin Beta-4 Can Promote Full-Thickness Cutaneous Wound Healing in BALB/c Micehttps://pubmed.ncbi.nlm.nih.gov/17923415/ Review Articles Thymosin β4: A Multifunctional Regenerative Peptidehttps://pubmed.ncbi.nlm.nih.gov/22074294/ Progress on the Function and Application of Thymosin β4https://pmc.ncbi.nlm.nih.gov/articles/PMC8724243/ Thymosin Beta-4 and the Eye: The Journey From Bench to Bedsidehttps://pubmed.ncbi.nlm.nih.gov/30063853/ Thymosin Beta-4: A Potential Novel Adjunct Treatment for Severe Refractory Atopic Dermatitishttps://pmc.ncbi.nlm.nih.gov/articles/PMC10403815/ Thymosin β4: A Potential Novel Dry Eye Therapyhttps://pubmed.ncbi.nlm.nih.gov/23050816/ The information provided on this page is intended for educational and informational purposes only. It is not intended to diagnose, treat, cure, or prevent any disease and should not be considered medical advice. This content was generated with the assistance of artificial intelligence (AI) and should be reviewed by a qualified medical professional before publication or clinical use. AI-generated medical content may contain errors, omissions, or outdated information. Thymosin Beta-4 is not FDA-approved for any medical indication in the United States. Any clinical use may be considered investigational or off-label depending on context. Individual results vary, and no specific outcome or benefit can be guaranteed. Patients should consult a qualified healthcare provider before beginning or changing any medical treatment. R2 Medical Clinic uses medications sourced from compounding pharmacies. Compounded medications are not approved by the U.S. Food and Drug Administration (FDA). Unlike FDA-approved medications, compounded drugs have not undergone FDA review for safety, effectiveness, or efficacy through the FDA drug approval process. While 503B outsourcing facilities are registered with and inspected by the FDA and must comply with Current Good Manufacturing Practice (CGMP) requirements, the compounded medications they produce are not individually approved by the FDA. Similarly, compounded medications prepared by 503A pharmacies are not FDA-approved and are primarily regulated by state boards of pharmacy, with FDA oversight under applicable federal law. # Thymosin Alpha-1 (Tα1)

RESEARCH

Angiogenesis and Endothelial Research: Re-Vascularisation of Infarcted Myocardium

Neovascularisation of the ischaemic border zone is critical for myocardial salvage and research applications. Tβ4 promotes cardiac angiogenesis through both direct endothelial cell effects (VEGFR2-PI3K-Akt-eNOS tube formation) and indirect cardiomyocyte paracrine effects (Tβ4-treated cardiomyocytes upregulate VEGF-A secretion). HUVEC tube formation assay (Matrigel GFR, 48-well format, IncuCyte quantification): Tβ4 (100 ng/mL-1 μg/mL) comparison to VEGF-A (50 ng/mL) positive control and SU5416 VEGFR2 inhibitor (1 μM) negative control. HUVEC migration (Boyden, VEGF-A 50 ng/mL lower chamber ± Tβ4 upper chamber: establishes whether Tβ4 is a direct motogen or requires VEGF-A). In vivo angiogenesis quantification: CD31 (PECAM-1) IHC (anti-CD31, BD Pharmingen 550274) in peri-infarct zone at 7d and 28d, image analysis (vessels/mm², vessel diameter distribution by image J, angiogenic index = vessel number × mean diameter²/field area). α-SMA+CD31 co-staining distinguishes mature arterioles (indicating functional neovascularisation supporting perfusion) from capillary sprouts (early angiogenesis). Laser Doppler perfusion imaging (LDPI, Moor Instruments LDI2) of post-infarct leg (hindlimb ischaemia model alternative) provides a non-invasive angiogenesis readout suitable for longitudinal tracking.

POTENTIAL BENEFITS

Anti-Aging Benefits

TB-4’s regenerative properties extend to skin health as well. It can help reduce the appearance of fine lines and wrinkles, improve skin elasticity, and promote a youthful complexion.
05

Product & matchup locker

Linked catalog and comparison files.

Comparison

10. TB-4 vs Other Healing Peptides

TB-4 Actin remodeling + angiogenesis Tissue repair, wound healing, cardiac models TB-500 Active fragment of TB-4 Similar repair benefits, smaller molecule, more stable BPC-157 Gro…