Skip to content
Recovery & Performance PeptidesRecovery research and practical context
Recovery article

Thymosin Beta 4 5mg TB500

Thymosin Beta 4 5mg TB500 Research Handling Note: For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Rec

By Recovery & Performance Peptides Editorial Team

Thymosin Beta 4 5mg TB500

Research Handling Note:

For best results in a research setting, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

Stock: 3147

Model: 5mg TB500

Molecular Formula: C212H350N56O78S - 5mg

SKU: TB5-022

Research Only: Yes

Certificate of analysis

Description

Technical Data

TB-500 5mg - High-Quality Research Peptide

TB-500, offered at 5mg, is a high-quality, specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.

Product Name: TB-500 5mg

Catalogue Number: TB500-5mg

Molecular Formula: C212H350N56O78S

Molecular Weight: 4963.4 g/mol

Purity: ≥98%

Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Form: Lyophilised Solid

Usage and Storage:

TB-500 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.

Synthesis and Quality Assurance:

TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides TB-500 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including TB-500, are not designed for human consumption or clinical application.

If you require high-quality TB-500 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Identification

Molecular Weight (g/mol)

4963.44 g/mol

Peptide Sequence

Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr- Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH

Physical and Chemical Properties

Molecular Formula

C212H350N56O78S

Physical Appearance

White lyophilised solid

Form

Sterile filtered white lyophilized (freeze-dried)

Solubility

Aqueous soluble

Appearance

White to off-white lyophilised powder

Melting Point

Not applicable (decomposes before melting)

Analytical and Quality Control

HPLC Result

Shows min 98% purity

Mass Spectrum

Consistent with structure

Purity %

>98%

Research Use and Safety

Caution

Research use only / Not for human or veterinary use

Intended Use

For laboratory research use only. Not for human or veterinary use.

Hazard Classification

Not classified as hazardous under GHS for research quantities

Storage, Handling and Stability

Storage Temperature, Opened

Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated below -18°C. Upon reconstitution of the peptide it should be stored at 4°C between 2-21 days and for future use below -18°C.

Storage Temperature, Unopened

-20 °C recommended for long-term storage

Shelf Life

2 years unopened under recommended conditions

Reconstitution Stability

Stable for up to 28 days at 2-8 °C in aqueous solution under sterile conditions

CONNECTED / MODULES

Post-session references

Selected from shared article topics. Source links are retained where available.

01

Handling & safety lane

Source-derived education, not individual medical guidance or an instruction to dose.

DOSAGE SOURCE

Weekly Dosing Reference · research convention, not a validated dose

Monday 30 750mcg Morning Thursday Weekly Total: 60 units (1,500mcg) • Vial Duration: ~17 days
03

Evidence cooldown

Research context and source excerpts for a slower second read.

RESEARCH

Thymosin Beta 4 (TB-500) and Related Research Studies

by Dr. Usman | Mar 30, 2022 | Research Thymosin Beta-4 has been documented by researchers to potentially play a role in protecting, regenerating, and remodeling damaged tissue cells. After any tissue injury, it is believed that Thymosin Beta-4 may be released by damaged cells to protect them and reduce the inflammatory process. This peptide is believed to be present in every tissue except red cells. Studies suggest that the first gene coding to occur (the process by which DNA and RNA dictate how and which cells need to form) after cell damage is Thymosin Beta-4. The formation of new blood vessels is believed to be essential to promote tissue repair. Damaged cells are believed to require early nutrients and supportive chemicals to reverse the damage. Thymosin Beta-4 is believed to have an angiogenic quality speculated to stimulate the migration and proliferation of endothelial cells.

RESEARCH

Cardiac Regeneration Research: Progenitor Cell Activation and Epicardial Biology

Tβ4’s most distinctive and research-generating cardiac biology is its capacity to stimulate dormant epicardial progenitor cell (EPC) activation and migration into the myocardium — a process normally quiescent in adult mammalian hearts but reactivated by cardiac injury. The epicardium (epicardium-derived cells, EPDCs) in the developing heart undergoes EMT (epithelial-mesenchymal transition) to generate smooth muscle cells, cardiac fibroblasts, and potentially cardiomyocytes — a process that is largely arrested in adults. Tβ4 reactivates this programme, identified by lineage tracing (WT1-Cre × Rosa26-lacZ or Rosa26-mTmG reporter mice where WT1+ epicardial cells are permanently labelled, detected by β-galactosidase activity or mGFP expression in post-injury myocardium). Research endpoints for epicardial progenitor activation: (i) WT1 (Wilms tumour 1) expression in epicardial layer by IHC (anti-WT1, DAKO M3561) — normally WT1+ only in embryonic heart, reactivated by injury + Tβ4; (ii) EPDC migration tracked by lineage-labelled cells in sub-epicardial and myocardial layers (β-gal histochemistry or GFP confocal); (iii) EMT markers: vimentin and E-cadherin co-expression on migrating EPDCs (E-cadherin downregulation → vimentin upregulation confirming EMT); (iv) newly generated SM cells (SMA+ NG2+ pericytes) and fibroblasts (vimentin+ DDR2+) in lineage-labelled EPDC-derived populations; (v) c-Kit+ cardiac progenitor cell density (IHC, anti-c-Kit, Santa Cruz sc-168) at infarct border zone 3-7d post-Tβ4 treatment confirming broader progenitor recruitment. 🔗 Related Reading: For broader context on peptide biology in cardiac and systemic protection, see our TB-500 Research Guide UK — TB-500 shares the same Tβ4 core sequence (LKKTET motif) and overlapping ILK/actin biology.

POTENTIAL BENEFITS

Anti-Aging Benefits

TB-4’s regenerative properties extend to skin health as well. It can help reduce the appearance of fine lines and wrinkles, improve skin elasticity, and promote a youthful complexion.
05

Product & matchup locker

Linked catalog and comparison files.

Comparison

Related Comparisons & Guides

TB-4 Dosing Guide — Clinical and preclinical dosing protocols, reconstitution, and injection routes TB-4 Injury Recovery Guide — How TB-4 supports recovery from specific injury ty…

Continue reading

Related articles